facebook_esm2_t33_650M_UR50D
facebook · View on Hugging Face ↗
Model card
The complete upstream card, rendered from this payload's README.md — the same hash-verified bytes the torrent distributes. Images and off-site links are removed; the original card on Hugging Face carries them.
license: mit widget:
- text: "MQIFVKTLTGKTITLEVEPSTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG"
ESM-2
ESM-2 is a state-of-the-art protein model trained on a masked language modelling objective. It is suitable for fine-tuning on a wide range of tasks that take protein sequences as input. For detailed information on the model architecture and training data, please refer to the accompanying paper. You may also be interested in some demo notebooks (PyTorch, TensorFlow) which demonstrate how to fine-tune ESM-2 models on your tasks of interest.
Several ESM-2 checkpoints are available in the Hub with varying sizes. Larger sizes generally have somewhat better accuracy, but require much more memory and time to train:
| Checkpoint name | Num layers | Num parameters |
|---|---|---|
| esm2_t48_15B_UR50D | 48 | 15B |
| esm2_t36_3B_UR50D | 36 | 3B |
| esm2_t33_650M_UR50D | 33 | 650M |
| esm2_t30_150M_UR50D | 30 | 150M |
| esm2_t12_35M_UR50D | 12 | 35M |
| esm2_t6_8M_UR50D | 6 | 8M |
Magnet link
Opens the swarm directly in your torrent client — no file download needed. Copy-paste works too:
magnet:?xt=urn:btih:40adb8108300c98ac00951339338b0edc944b6c0&dn=facebook_esm2_t33_650M_UR50DOpen magnet in torrent client · infohash 40adb8108300c98ac00951339338b0edc944b6c0
Files & hashes
| Path | Size | sha1 | sha256 |
|---|---|---|---|
| README.md | 1.7 KB (1,705 B) | 78b8e54d14b2ccb65a6f3456cc72e603ddd8658d | 462a2f24724e19c6be0efab926315c294a863c9a9770e2c8b3d859b2d81a07de |
| config.json | 724 B (724 B) | a956a25d277f30bd870d3760b9a116f19ead885e | 539095c22efc52a09d6147074ba4ca119f76a890df5901213b2b55f7d2f96b2b |
| model.safetensors | 2.43 GB (2,609,506,392 B) | 126a72647fa2eb5bf0d1f66a5f97ad5f6a866c53 | a08adabb949fa67ad3c14b509d04fd60368b35007b0095e3358f81200c4f4db0 |
| pytorch_model.bin | 2.43 GB (2,609,621,831 B) | 46ff0086af2ee8ba1a101d521804e1f6e88a74f5 | c874668852c7275a159e2c7ceb6069671d7b1ba2c7b52f59600b34ce0f721008 |
| special_tokens_map.json | 125 B (125 B) | ba0f9b53dbbf27934f7555e5d31e37bdea9317f1 | 3aedcd4211c0d43aec4e607ff60a63255f3174ead795e997350f09a5f8cd9ee1 |
| tokenizer_config.json | 95 B (95 B) | 3f0d47e841e1cb75257aeaf76d156802899a217e | 7e9161ecdb548ec45a41cbc6b24aa4476fdd418461f491c4207baa99419a29ad |
| vocab.txt | 93 B (93 B) | 6b946952cc35537226f07fd70957ee2f848880d2 | 0b82cc0a7c7cf9e567b1e5892d793285b9fbae822c964ca48696f7db44598e03 |
Cite this release
- Canonical URL
- https://aiseedbank.org/models/facebook_esm2_t33_650M_UR50D/
- Slug
- facebook_esm2_t33_650M_UR50D
- Infohash
- 40adb8108300c98ac00951339338b0edc944b6c0
- License
- mit
- Signing key fingerprint
- 85a3b32c3712427b
Every file carries a locally computed sha256 — verify a download against the signed sums: facebook_esm2_t33_650M_UR50D.SHA256SUMS (+ minisign signature).
Provenance
| Upstream repository | facebook/esm2_t33_650M_UR50D |
|---|---|
| Revision (pinned) | 08e4846e537177426273712802403f7ba8261b6c |
| Fetched at | 2026-09-03T22:34:09Z |
| License at fetch | mit |
| Snapshot tool | huggingface · seedbank 0.1.0 |
Trackers
- udp://announce.aitorrent.org:6969/announce
- http://announce.aitorrent.org:7070/announce
- udp://announce2.aitorrent.org:6970/announce
- http://announce2.aitorrent.org:7071/announce
- udp://tracker.opentrackr.org:1337/announce
- udp://open.demonii.com:1337/announce
- udp://open.stealth.si:80/announce
- udp://exodus.desync.com:6969/announce
- udp://tracker.torrent.eu.org:451/announce
✓ verified · rehash-vs-hf-metadata at 2026-09-03T22:35:06Z
mit4.86 GB (5,219,130,965 bytes)transformerspytorchsafetensorsesmfill-maskendpoints_compatible1 language (tf)